BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targettrace amine-associated receptor 1
LigandBDBM60917
Substrate/Competitorn/a
IC50 8044±n/a nM
Citation PubChem, PC Counterscreen for agonists of the human trace amine associated receptor 1 (hTAAR1): Fluorescence-based cell-based high throughput dose response assay to identify hTAAR1 agonist that also desensitize TAAR1 receptor response. PubChem Bioassay(2013)[AID]
More Info.:Get all data from this article
 
trace amine-associated receptor 1
Name:Trace amine-associated receptor 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:39107.47
Organism:Homo sapiens (Human)
Description:ChEMBL_792734
Residue:339
Sequence:
MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNW
LIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISID
RYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRG
GCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNG
ISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFN
PMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM60917
NameBDBM60917
Synonyms:9-chloranyl-5-(4-hydroxyphenyl)-2,3,4,5-tetrahydro-1H-3-benzazepine-7,8-diol;methanesulfonic acid | 9-chloro-5-(4-hydroxyphenyl)-2,3,4,5-tetrahydro-1H-3-benzazepine-7,8-diol;mesylic acid | 9-chloro-5-(4-hydroxyphenyl)-2,3,4,5-tetrahydro-1H-3-benzazepine-7,8-diol;methanesulfonic acid | FENOLDOPAM | FENOLDOPAM MESYLATE | MLS001401388 | SMR000469190 | cid_49659
TypeSmall organic molecule
Emp. Form.C16H16ClNO3
Mol. Mass.305.756
SMILESOc1ccc(cc1)C1CNCCc2c(Cl)c(O)c(O)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a