Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity mitogen-activated protein kinase kinase 1
LigandBDBM1714
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
IC50<5±n/a nM
Citation Dong, QKaldor, SW MAPK/ERK kinase inhibitors US Patent US8470837 Publication Date 6/25/2013
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Dual specificity mitogen-activated protein kinase kinase 1
Name:Dual specificity mitogen-activated protein kinase kinase 1
Synonyms:n/a
Type:Protein
Mol. Mass.:40898.07
Organism:Homo sapiens (human)
Description:n/a
Residue:372
Sequence:
PKKKPTPIQLNPAPDGSAVNGTSSAETNLEAFLTQKQKVGELKDDDFEKISELGAGNGGV
VFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISI
CMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSR
GEIKLCDFGVSGQLIDEMANDFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRY
PIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEP
PPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGL
NQPSTPTHAAGV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM1714
n/a
NameBDBM1714
Synonyms:CHEMBL1684071 | US8470837, 13
Typen/a
Emp. Form.C18H18FIN4O4
Mol. Mass.500.2628
SMILESCc1c(Nc2ccc(I)cc2F)c2c(ncn(C[C@H](O)CO)c2=O)n(C)c1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: