Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity mitogen-activated protein kinase kinase 1
LigandBDBM1716
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
pH7.3±n/a
Temperature298.15±n/a K
IC50 10±n/a nM
Commentsextracted
Citation Dong, QKaldor, SW MAPK/ERK kinase inhibitors US Patent US8470837 Publication Date 6/25/2013
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Dual specificity mitogen-activated protein kinase kinase 1
Name:Dual specificity mitogen-activated protein kinase kinase 1
Synonyms:n/a
Type:Protein
Mol. Mass.:40898.07
Organism:Homo sapiens (Human)
Description:n/a
Residue:372
Sequence:
PKKKPTPIQLNPAPDGSAVNGTSSAETNLEAFLTQKQKVGELKDDDFEKISELGAGNGGV
VFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISI
CMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSR
GEIKLCDFGVSGQLIDEMANDFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRY
PIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEP
PPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGL
NQPSTPTHAAGV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM1716
NameBDBM1716
Synonyms:CHEMBL1684072 | US8470837, 17
Typen/a
Emp. Form.C16H13F2IN4O3
Mol. Mass.474.2007
SMILESCn1c2ncn(CCO)c(=O)c2c(Nc2ccc(I)cc2F)c(F)c1=O
Structure
n/a