Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlasmin
LigandBDBM98593
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
Temperature297.15±0 K
Ki 960±0.0 nM
Citation Stuerzebecher, JSteinmetzer, TSchweinitz, A Urokinase inhibitors, production and use thereof US Patent US8476306 Publication Date 7/2/2013
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Plasmin
Name:Plasminogen
Synonyms:Plg
Type:Protein
Mol. Mass.:90541.87
Organism:Rattus norvegicus
Description:Q01177
Residue:812
Sequence:
MDHKEIILLFLLFLKPGQGDSLDGYVSTQGASLHSLTKKQLAAGSIADCLAKCEGETDFI
CRSFQYHSKEQQCVIMAENSKTSSIIRMRDVILFEKRVYLSECKTGIGKGYRGTMSKTKT
GVTCQKWSDTSPHVPKYSPSTHPSEGLEENYCRNPDNDEQGPWCYTTDPDQRYEYCNIPE
CEEECMYCSGEKYEGKISKTMSGLDCQSWDSQSPHAHGYIPAKFPSKNLKMNYCRNPDGE
PRPWCFTTDPNKRWEYCDIPRCTTPPPPPGPTYQCLKGRGENYRGTVSVTASGKTCQRWS
EQTPHRHNRTPENFPCKNLEENYCRNPDGETAPWCYTTDSQLRWEYCEIPSCGSSVSPDQ
SDSSVLPEQTPVVQECYQGNGKSYRGTSSTTNTGKKCQSWVSMTPHSHSKTPANFPDAGL
EMNYCRNPDNDQRGPWCFTTDPSVRWEYCNLKRCSETGGGVAESAIVPQVPSAPGTSETD
CMYGNGKEYRGKTAVTAAGTPCQEWAAQEPHSHRIFTPQTNPRAGLEKNYCRNPDGDVNG
PWCYTMNPRKLYDYCNIPLCASLSSFECGKPQVEPKKCPGRVVGGCVANPHSWPWQISLR
TRFSGQHFCGGTLISPEWVLTAAHCLEKSSRPEFYKVILGAHEERILGSDVQQIAVTKLV
LEPNDADIALLKLSRPATITDNVIPACLPSPNYVVADRTLCYITGWGETKGTPGAGRLKE
AQLPVIENKVCNRAEYLNNRVKSTELCAGHLAGGIDSCQGDSGGPLVCFEKDKYILQGVT
SWGLGCARPNKPGVYVRVSRYVNWIEREMRND
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM98593
NameBDBM98593
Synonyms:US8476306, 6.19 | methyl 4-[[(1R)-2-[[(1S)-2-[(4-carbamimidoylphenyl)methylamino]-1-(hydroxymethyl)-2-oxo-ethyl]amino]-1-(hydroxymethyl)-2-oxo-ethyl]sulfamoylmethyl]benzoate
TypeSmall organic molecule
Emp. Form.C23H29N5O8S
Mol. Mass.535.57
SMILESCOC(=O)c1ccc(CS(=O)(=O)N[C@H](CO)C(=O)N[C@@H](CO)C(=O)NCc2ccc(cc2)C(N)=N)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a