Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThrombin
LigandBDBM98595
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
Temperature297.15±0 K
Ki 8000±0.0 nM
Citation Stuerzebecher, JSteinmetzer, TSchweinitz, A Urokinase inhibitors, production and use thereof US Patent US8476306 Publication Date 7/2/2013
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Thrombin
Name:Thrombin
Synonyms:Activated blood-coagulation factor II | Activation peptide fragment 1 | Activation peptide fragment 2 | Beta-thrombin | Blood-coagulation factor IIa | Coagulation factor II | E thrombin | Factor IIa | Fibrinogenase | Gamma-thrombin | Prothrombin | Thrombase | Thrombin heavy chain | Thrombin light chain | Thrombin-C | Thrombofort | Tropostasin
Type:Protein
Mol. Mass.:70413.05
Organism:Rattus norvegicus
Description:P18292
Residue:617
Sequence:
MLHVRGLGLPGCLALAALASLVHSQHVFLAPQQALSLLQRVRRANSGFLEELRKGNLERE
CVEEQCSYEEAFEALESPQDTDVFWAKYTVCDSVRKPRETFMDCLEGRCAMDLGLNYHGN
VSVTHTGIECQLWRSRYPHRPDINSTTHPGADLKENFCRNPDSSTSGPWCYTTDPTVRRE
ECSIPVCGQEGRTTVKMTPRSRGSKENLSPPLGECLLERGRLYQGNLAVTTLGSPCLAWD
SLPTKTLSKYQNFDPEVKLVQNFCRNPDRDEEGAWCFVAQQPGFEYCSLNYCDEAVGEEN
HDGDESIAGRTTDAEFHTFFDERTFGLGEADCGLRPLFEKKSLTDKTEKELLDSYIDGRI
VEGWDAEKGIAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCILYPPWDKNFTENDLLV
RIGKHSRTRYERNVEKISMLEKIYIHPRYNWRENLDRDIALLKLKKPVPFSDYIHPVCLP
DKQTVTSLLQAGYKGRVTGWGNLRETWTTNINEIQPSVLQVVNLPIVERPVCKASTRIRI
TDNMFCAGFKVNDTKRGDACEGDSGGPFVMKSPYNHRWYQMGIVSWGEGCDRNGKYGFYT
HVFRLKRWMQKVIDQHR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM98595
NameBDBM98595
Synonyms:(2R)-N-[2-[(4-carbamimidoylphenyl)methylamino]-2-oxo-ethyl]-3-hydroxy-2-(p-tolylmethylsulfonylamino)propanamide | US8476306, 6.21
TypeSmall organic molecule
Emp. Form.C21H27N5O5S
Mol. Mass.461.535
SMILESCc1ccc(CS(=O)(=O)N[C@H](CO)C(=O)NCC(=O)NCc2ccc(cc2)C(N)=N)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a