Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetChymase
LigandBDBM100308
Substrate/Competitorn/a
Meas. Tech.In Vitro Assay
pH8±0
Temperature301.15±0 K
IC50 6.1±0.0 nM
Citation Guo, XMan, CCTakahashi, H Azaquinazolinediones chymase inhibitors US Patent US8501749 Publication Date 8/6/2013
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Chymase
Name:Chymase
Synonyms:Alpha-chymase | Chymase precursor | Mast cell protease I
Type:Enzyme
Mol. Mass.:27340.12
Organism:Homo sapiens (Human)
Description:n/a
Residue:247
Sequence:
MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
NQILQAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM100308
NameBDBM100308
Synonyms:US8501749, 8
TypeSmall organic molecule
Emp. Form.C20H18N4O4
Mol. Mass.378.3813
SMILESCc1cccc2n(C)cc(Cn3c4cccnc4c(=O)n(CC(O)=O)c3=O)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a