Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetALK1
LigandBDBM102618
Substrate/Competitorn/a
IC50 2.4±0.0 nM
Citation Mohedas, AHXing, XArmstrong, KABullock, ANCuny, GDYu, PB Development of an ALK2-Biased BMP Type I Receptor Kinase Inhibitor. ACS Chem Biol8:1291-302 (2013) [PubMed]  Article
More Info.:Get all data from this article
 
ALK1
Name:ALK1
Synonyms:AI115505 | AI427544 | Acvrlk1
Type:Protein
Mol. Mass.:56529.91
Organism:Mus musculus
Description:n/a
Residue:502
Sequence:
MTLGSFRRGLLMLSVAFGLTRGDLAKPSKLVNCTCESPHCKRPFCQGSWCTVVLVREQGR
HPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDAHLPL
ILGPVLALPVLVALGALGLWRVRRRQEKQRDLHSDLGESSLILKASEQADSMLGDFLDSD
CTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGSWHGESVAVKIFSSRDEQSWFR
ETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEHGSLYDFLQRQTLEPQLALR
LAVSAACGLAHLHVEIFGTQGKPAIAHRDLKSRNVLVKSNLQCCIADLGLAVMHSQSSDY
LDIGNNPRVGTKRYMAPEVLDEHIRTDCFESYKWTDIWAFGLVLWEIARRTIINGIVEDY
RPPFYDMVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLT
ALRIKKTLQKLSHNPEKPKVIH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM102618
NameBDBM102618
Synonyms:LDN-212854
TypeSmall organic molecule
Emp. Form.C25H22N6
Mol. Mass.406.4824
SMILESC1CN(CCN1)c1ccc(cc1)-c1cnc2c(cnn2c1)-c1cccc2ncccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a