Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetALK2
LigandBDBM102618
Substrate/Competitorn/a
IC50 1.3±0.0 nM
Citation Mohedas, AHXing, XArmstrong, KABullock, ANCuny, GDYu, PB Development of an ALK2-Biased BMP Type I Receptor Kinase Inhibitor. ACS Chem Biol8:1291-302 (2013) [PubMed]  Article
More Info.:Get all data from this article
 
ALK2
Name:ALK2
Synonyms:ActR-I | ActRIA | Acvr | Acvrlk2
Type:Protein
Mol. Mass.:57231.35
Organism:Mus musculus
Description:n/a
Residue:509
Sequence:
MVDGVMILPVLMMMAFPSPSVEDEKPKVNQKLYMCVCEGLSCGNEDHCEGQQCFSSLSIN
DGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF
HLEVGLIILSVVFAVCLLACILGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTL
AELLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSR
DEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTL
DTVSCLRIVLSIASGLAHLHIEIFGTQGKSAIAHRDLKSKNILVKKNGQCCIADLGLAVM
HSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVS
NGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQ
NPSARLTALRIKKTLTKIDNSLDKLKTDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM102618
n/a
NameBDBM102618
Synonyms:LDN-212854
TypeSmall organic molecule
Emp. Form.C25H22N6
Mol. Mass.406.4824
SMILESC1CN(CCN1)c1ccc(cc1)-c1cnc2c(cnn2c1)-c1cccc2ncccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: