Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target3-phosphoinositide-dependent protein kinase 1
LigandBDBM104018
Substrate/Competitorn/a
Meas. Tech.AlphaScreen Assay
pH7.4±n/a
Temperature273.15±n/a K
IC50 2.6e+4±n/a nM
Citation Pastor-Flores, DSchulze, JOBah, ABahí, RFerrer-Dalmau, JPasseron, SEngel, MSss, ESüss, ABiondi, RM PIF-pocket as a target for C. albicans Pkh selective inhibitors. ACS Chem Biol8:2283-92 (2013) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
3-phosphoinositide-dependent protein kinase 1
Name:3-phosphoinositide-dependent protein kinase 1
Synonyms:3-Phosphoinositide-Dependent Protein Kinase 1 (PDK1) | 3-phosphoinositide dependent protein kinase-1 | 3-phosphoinositide-dependent protein kinase 1 | 3-phosphoinositide-dependent protein kinase 1 (PDK) | 3-phosphoinositide-dependent protein kinase 1 (PDK-1) | 3-phosphoinositide-dependent protein kinase 1 (PDK1)(Δ1-50) | Isoform 2 of 3-phosphoinositide-dependent protein kinase 1 | PDK1 | PDPK1 | Phosphoinositide-dependent protein kinase 1 (PDK1) | Pyruvate dehydrogenase kinase isoenzyme 1 (PDK1) | hPDK1
Type:Enzyme
Mol. Mass.:63157.65
Organism:Homo sapiens (Human)
Description:O15530
Residue:556
Sequence:
MARTTSQLYDAVPIQSSVVLCSCPSPSMVRTQTESSTPPGIPGGSRQGPAMDGTAAEPRP
GAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIK
ENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDET
CTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARAN
SFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYD
FPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTA
YLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLD
SNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTE
GPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQ
EVWRQRYQSHPDAAVQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM104018
NameBDBM104018
Synonyms:PS182
TypeSmall organic molecule
Emp. Form.C18H15ClO5
Mol. Mass.346.762
SMILESOC(=O)C(C(CC(=O)c1ccc(Cl)cc1)c1ccccc1)C(O)=O
Structure
n/a