Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetα-glucosidase
LigandBDBM108224
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay Against Commercial Glycosidases
IC50 1.05e+3± 0 nM
Citation Li, ZLi, TDai, SXie, XMa, XZhao, WZhang, WLi, JWang, PG New insights into the pharmacological chaperone activity of c2-substituted glucoimidazoles for the treatment of Gaucher disease. Chembiochem14:1239-47 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
α-glucosidase
Name:α-glucosidase
Synonyms:Alpha-glucosidase | Alpha-glucosidase (α-glucosidase) | Oligo-1,6-glucosidase
Type:Protein
Mol. Mass.:68577.59
Organism:Saccharomyces cerevisiae S288c (Baker's yeast)
Description:n/a
Residue:589
Sequence:
MTISSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWIS
PFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWF
KESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCS
TQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQS
SDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGEMQHASDETKRLYTSASRHELSEL
FNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRF
GDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIK
EEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGIN
VEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAA
LNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM108224
NameBDBM108224
Synonyms:N-phenyl-4-[6,7,8-trihydroxy-5-(hydroxymethyl)- 5H,6H,7H,8H-imidazo[1,2-a]pyridin-2-yl]butanamide (Compound 10)
TypeSmall organic molecule
Emp. Form.C18H23N3O5
Mol. Mass.361.3923
SMILESOCC1C(O)C(O)C(O)c2nc(CCCC(=O)Nc3ccccc3)cn12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a