Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin-1
LigandBDBM109667
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
Ki 0.39±0.0 nM
Citation Konishi, ATokumasu, MSuzuki, TKoshiba, TOhsumi, KIkehara, OKodama, Y Heteroarylcarboxylic acid ester derivative US Patent US8609715 Publication Date 12/17/2013
More Info.:Get all data from this article,  Assay Method
 
Trypsin-1
Name:Trypsin
Synonyms:Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | Serine protease 1 | Trypsin
Type:Enzyme
Mol. Mass.:26557.80
Organism:Homo sapiens (human)
Description:P07477
Residue:247
Sequence:
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM109667
NameBDBM109667
Synonyms:US8609715, C-2
TypeSmall organic molecule
Emp. Form.C20H22N4O6S
Mol. Mass.446.477
SMILESC\C(=C/c1nc(cs1)C(=O)Oc1ccc(cc1)C(N)=N)C(=O)N(CCCO)CC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a