Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDOPA decarboxylase (DDC)
LigandBDBM48449
Substrate/Competitorn/a
Meas. Tech.DDC-MDH-PEPC-Linked assay
IC50 1.200e+6± 3.9e+3 nM
Citation Ren, JZhang, YJin, HYu, JZhou, YWu, FZhang, W Novel inhibitors of human DOPA decarboxylase extracted from Euonymus glabra Roxb. ACS Chem Biol9:897-903 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DOPA decarboxylase (DDC)
Name:DOPA decarboxylase (DDC)
Synonyms:Aromatic-L-amino-acid decarboxylase | DDC
Type:Protein
Mol. Mass.:53899.74
Organism:Homo sapiens (Human)
Description:n/a
Residue:480
Sequence:
MNASEFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDV
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIM
EKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMV
ATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVN
EALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAERE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM48449
NameBDBM48449
Synonyms:3-(3,4-DIHYDROXYPHENYL)-2-METHYL-L-ALANINE | METHYLDOPA | MLS000028644 | SMR000059170 | cid_38853
TypeSmall organic molecule
Emp. Form.C10H13NO4
Mol. Mass.211.2145
SMILESC[C@](N)(Cc1ccc(O)c(O)c1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a