Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGag-Pol polyprotein [484-582,Q491K,I497V,V499I,E519D,R541K,D544E,L547P,Q553K,A555V,G557S,I568V,L573M,L574M]
LigandBDBM112657
Substrate/Competitorn/a
Meas. Tech.HIV-1 protease inhibition assay
pH4.7±n/a
Temperature298.15±n/a K
Ki 0.099±0.089 nM
Commentsextracted
Citation Nalam, MNAli, AReddy, GSCao, HAnjum, SGAltman, MDYilmaz, NKTidor, BRana, TMSchiffer, CA Substrate envelope-designed potent HIV-1 protease inhibitors to avoid drug resistance. Chem Biol20:1116-24 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Gag-Pol polyprotein [484-582,Q491K,I497V,V499I,E519D,R541K,D544E,L547P,Q553K,A555V,G557S,I568V,L573M,L574M]
Name:Gag-Pol polyprotein [484-582,Q491K,I497V,V499I,E519D,R541K,D544E,L547P,Q553K,A555V,G557S,I568V,L573M,L574M]
Synonyms:HIV-1 protease M2
Type:Protein
Mol. Mass.:10804.78
Organism:Human immunodeficiency virus
Description:HIV-1 protease mutant (L10I, L63P, A71V, G73S, I84V, L90M)
Residue:99
Sequence:
PQITLWKRPIVTVKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
QVPIEICGKKVISTVLVGPTPVNVIGRNMMTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM112657
NameBDBM112657
Synonyms:(3R,3aS,6aR)-Hexahydrofuro[2,3-b]furan-3-yl ((2S,3R)-3-hydroxy-4-(N-((S)-2-methylbutyl)benzo[d][1,3]dioxole-5-sulfonamido)-1-phenylbutan-2-yl)carbamate (10d)
TypeSmall organic molecule
Emp. Form.C29H38N2O9S
Mol. Mass.590.685
SMILESCC[C@H](C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)O[C@H]1CO[C@H]2OCC[C@@H]12)S(=O)(=O)c1ccc2OCOc2c1
Structure
n/a