Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlucagon receptor
LigandBDBM113052
Substrate/Competitorn/a
Meas. Tech.Glucagon Receptor Binding Assay
pH7.4±n/a
Temperature298.15±n/a K
IC50 3500±n/a nM
Commentsextracted
Citation DeMong, DMiller, MWDai, XStamford, A Substituted imidazolones, compositions containing such compounds and methods of use US Patent US8633231 Publication Date 1/21/2014
More Info.:Get all data from this article,  Assay Method
 
Glucagon receptor
Name:Glucagon receptor
Synonyms:GL-R | Glucagon Receptor (GCGR) | Glucagon receptor (GlucR)
Type:Enzyme
Mol. Mass.:54026.92
Organism:Homo sapiens (Human)
Description:P47871
Residue:477
Sequence:
MPPCQPQRPLLLLLLLLACQPQVPSAQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNR
TFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQ
CQMDGEEIEVQKEVAKMYSSFQVMYTVGYSLSLGALLLALAILGGLSKLHCTRNAIHANL
FASFVLKASSVLVIDGLLRTRYSQKIGDDLSVSTWLSDGAVAGCRVAAVFMQYGIVANYC
WLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPMLFVVPWAVVKCLFENVQCWTSNDN
MGFWWILRFPVFLAILINFFIFVRIVQLLVAKLRARQMHHTDYKFRLAKSTLTLIPLLGV
HEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRL
GKVLWEERNTSNHRASSSPGHGPPSKELQFGRGGGSQDSSAETPLAGGLPRLAESPF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM113052
NameBDBM113052
Synonyms:US8633231, 15
TypeSmall organic molecule
Emp. Form.C29H34F3N3O4
Mol. Mass.545.5932
SMILESCC1(NC(C(=O)N1CCc1ccc(cc1)C(=O)NCCC(O)=O)c1cccc(c1)C(F)(F)F)C1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a