Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProto-oncogene tyrosine-protein kinase Src
LigandBDBM4492
Substrate/Competitorcdc2 substrate peptide
Meas. Tech.Kinase Inhibition Assay
pH7.5±n/a
Temperature303.15±n/a K
IC50 30±n/a nM
Citation Boschelli, DHYe, FWang, YDDutia, MJohnson, SLWu, BMiller, KPowell, DWYaczko, DYoung, MTischler, MArndt, KDiscafani, CEtienne, CGibbons, JGrod, JLucas, JWeber, JMBoschelli, F Optimization of 4-phenylamino-3-quinolinecarbonitriles as potent inhibitors of Src kinase activity. J Med Chem44:3965-77 (2001) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Proto-oncogene tyrosine-protein kinase Src
Name:Proto-oncogene tyrosine-protein kinase Src
Synonyms:Proto-oncogene c-Src | Proto-oncogene tyrosine-protein kinase Src (c-Src) | SRC | Tyrosine-protein kinase Src (SRC) | V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) | c-Src | p60-Src | pp60c-src
Type:Protein
Mol. Mass.:59838.60
Organism:Homo sapiens (Human)
Description:P12931
Residue:536
Sequence:
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM4492
NameBDBM4492
Synonyms:4-[(2,4-Dichlorophenyl)amino]-6,7-dimethoxy-3-quinolinecarbonitrile | 4-[(2,4-dichlorophenyl)amino]-6,7-dimethoxyquinoline-3-carbonitrile | 6,7-Dimethoxyquinoline deriv. 2a | CHEMBL101917
TypeSmall organic molecule
Emp. Form.C18H13Cl2N3O2
Mol. Mass.374.221
SMILESCOc1cc2ncc(C#N)c(Nc3ccc(Cl)cc3Cl)c2cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
cdc2 substrate peptide
Name:cdc2 substrate peptide
Synonyms:n/a
Type:Peptide
Mol. Mass.:358.43
Organism:n/a
Description:100 uM ATP as co-substrate
Residue:3
Sequence:
n/a