Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-glucosidase A (α-Gal A)
LigandBDBM113760
Substrate/Competitorn/a
Meas. Tech.α-Gal A Assay
pH7±0
IC50 2.18e+3± 3.9e+2 nM
Citation Yu, YMena-Barragán, TMena-Barragán, KJohnson, JLDrury, JELieberman, RLNakasone, NNinomiya, HTsukimura, TSakuraba, HSuzuki, YNanba, EMellet, COGarcía Fernández, JMGarcía Fernández, K Molecular Basis of 1-Deoxygalactonojirimycin Arylthiourea Binding to Human a-Galactosidase A: Pharmacological Chaperoning Efficacy on Fabry Disease Mutants. ACS Chem Biol9:1460-9 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-glucosidase A (α-Gal A)
Name:Alpha-galactosidase A
Synonyms:Alpha-D-galactosidase A | Alpha-D-galactoside galactohydrolase | INN=Agalsidase | Melibiase
Type:Protein
Mol. Mass.:48760.21
Organism:Homo sapiens (Human)
Description:n/a
Residue:429
Sequence:
MQLRNPELHLGCALALRFLALVSWDIPGARALDNGLARTPTMGWLHWERFMCNLDCQEEP
DSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQL
ANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLENL
ADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQKPNYTEIRQYCNHWRNFADIDDSWKSIK
SILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMAAPLFMSNDL
RHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWAVAMINRQEIG
GPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVLLQLENT
MQMSLKDLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM113760
NameBDBM113760
Synonyms:pF PhIM-DGJ
TypeSmall organic molecule
Emp. Form.C13H15FN2O3S
Mol. Mass.298.333
SMILESO[C@H]1CN2C(CS\C2=N\c2ccc(F)cc2)[C@H](O)[C@@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a