BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDisintegrin and metalloproteinase domain-containing protein 10 (ADAM10)
LigandBDBM70806
Substrate/Competitorn/a
Meas. Tech.Counterscreen for exosite inhibitors of ADAM17: Fluorescence resonance energy transfer (FRET)-based biochemical high throughput dose response assay to identify inhibitors of ADAM10
IC50 7724±n/a nM
Citation PubChem, PC Counterscreen for exosite inhibitors of ADAM17: Fluorescence resonance energy transfer (FRET)-based biochemical high throughput dose response assay to identify inhibitors of ADAM10 PubChem Bioassay(2014)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Disintegrin and metalloproteinase domain-containing protein 10 (ADAM10)
Name:ADAM10
Synonyms:ADAM10
Type:Enzyme
Mol. Mass.:84160.93
Organism:Homo sapiens (Human)
Description:O14672
Residue:748
Sequence:
MVLLRVLILLLSWAAGMGGQYGNPLNKYIRHYEGLSYNVDSLHQKHQRAKRAVSHEDQFL
RLDFHAHGRHFNLRMKRDTSLFSDEFKVETSNKVLDYDTSHIYTGHIYGEEGSFSHGSVI
DGRFEGFIQTRGGTFYVEPAERYIKDRTLPFHSVIYHEDDINYPHKYGPQGGCADHSVFE
RMRKYQMTGVEEVTQIPQEEHAANGPELLRKKRTTSAEKNTCQLYIQTDHLFFKYYGTRE
AVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTADEKDPTNPFRFPNIGVEKF
LELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLNT
GIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYAR
ATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCK
DECCFDANQPEGRKCKLKPGKQCSPSQGPCCTAQCAFKSKSEKCRDDSDCAREGICNGFT
ALCPASDPKPNFTDCNRHTQVCINGQCAGSICEKYGLEECTCASSDGKDDKELCHVCCMK
KMDPSTCASTGSVQWSRHFSGRTITLQPGSPCNDFRGYCDVFMRCRLVDADGPLARLKKA
IFSPELYENIAEWIVAHWWAVLLMGIALIMLMAGFIKICSVHTPSSNPKLPPPKPLPGTL
KRRRPPQPIQQPQRQRPRESYQMGHMRR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM70806
NameBDBM70806
Synonyms:10-Furan-2-ylmethyl-12-phenyl-10,12-dihydro-7-oxa-8,10-diaza-benzo[a]anthracen-11-ylideneamine | MLS000331568 | SMR000220659 | cid_4691858
TypeSmall organic molecule
Emp. Form.C26H19N3O2
Mol. Mass.405.448
SMILESN=c1c2C(c3ccccc3)c3c(Oc2ncn1Cc1ccco1)ccc1ccccc31
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a