BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGroup III secretory phopholipase A2
LigandBDBM88194
Substrate/Competitorn/a
Meas. Tech.QFRET-based biochemical high throughput dose response assay to identify inhibitors of human group III secreted phospholipase A2 enzyme (HGIII-sPLA2)
IC50 121916±n/a nM
Citation PubChem, PC QFRET-based biochemical high throughput dose response assay to identify inhibitors of human group III secreted phospholipase A2 enzyme (HGIII-sPLA2) PubChem Bioassay(2014)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Group III secretory phopholipase A2
Name:Group III secretory phopholipase A2
Synonyms:phospholipase A2, group III
Type:PROTEIN
Mol. Mass.:57180.58
Organism:Homo sapiens (Human)
Description:EBI_100830
Residue:509
Sequence:
MGVQAGLFGMLGFLGVALGGSPALRWYRTSCHLTKAVPGNPLGYLSFLAKDAQGLALIHA
RWDAHRRLQACSWEDEPELTAAYGALCAHETAWGSFIHTPGPELQRALATLQSQWEACRA
LEESPAGARKKRAAGQSGVPGGGHQREKRGWTMPGTLWCGVGDSAGNSSELGVFQGPDLC
CREHDRCPQNISPLQYNYGIRNYRFHTISHCDCDTRFQQCLQNQHDSISDIVGVAFFNVL
EIPCFVLEEQEACVAWYWWGGCRMYGTVPLARLQPRTFYNASWSSRATSPTPSSRSPAPP
KPRQKQHLRKGPPHQKGSKRPSKANTTALQDPMVSPRLDVAPTGLQGPQGGLKPQGARWV
CRSFRRHLDQCEHQIGPREIEFQLLNSAQEPLFHCNCTRRLARFLRLHSPPEVTNMLWEL
LGTTCFKLAPPLDCVEGKNCSRDPRAIRVSARHLRRLQQRRHQLQDKGTDERQPWPSEPL
RGPMSFYNQCLQLTQAARRPDRQQKSWSQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM88194
NameBDBM88194
Synonyms:4-nitro-N-[(salicyloylamino)thiocarbamoyl]benzamide | MLS001205000 | N-[N'-(2-Hydroxy-benzoyl)-hydrazinocarbothioyl]-4-nitro-benzamide | N-[[(2-hydroxybenzoyl)amino]carbamothioyl]-4-nitrobenzamide | N-[[(2-hydroxyphenyl)carbonylamino]carbamothioyl]-4-nitro-benzamide | N-[[[(2-hydroxyphenyl)-oxomethyl]hydrazo]-sulfanylidenemethyl]-4-nitrobenzamide | SMR000517398 | cid_3138342
TypeSmall organic molecule
Emp. Form.C15H12N4O5S
Mol. Mass.360.345
SMILESOc1ccccc1C(=O)NNC(=S)NC(=O)c1ccc(cc1)[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a