BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha trans-inducing protein (VP16)
LigandBDBM34505
Substrate/Competitorn/a
Meas. Tech.Counterscreen for inhibitors of COUP-TFII (NR2F2): Luminescence-based cell-based high throughput dose response assay to identify inhibitors of the Herpes Virus Virion Protein 16 (VP16)
IC50 85379±n/a nM
Citation PubChem, PC Counterscreen for inhibitors of COUP-TFII (NR2F2): Luminescence-based cell-based high throughput dose response assay to identify inhibitors of the Herpes Virus Virion Protein 16 (VP16) PubChem Bioassay(2013)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Alpha trans-inducing protein (VP16)
Name:Alpha trans-inducing protein (VP16)
Synonyms:transactivating tegument protein VP16
Type:PROTEIN
Mol. Mass.:54325.13
Organism:Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus1)
Description:EBI_100271
Residue:490
Sequence:
MDLLVDELFADMNADGASPPPPRPAGGPKNTPAAPPLYATGRLSQAQLMPSPPMPVPPAA
LFNRLLDDLGFSAGPALCTMLDTWNEDLFSALPTNADLYRECKFLSTLPSDVVEWGDAYV
PERTQIDIRAHGDVAFPTLPATRDGLGLYYEALSRFFHAELRAREESYRTVLANFCSALY
RYLRASVRQLHRQAHMRGRDRDLGEMLRATIADRYYRETARLARVLFLHLYLFLTREILW
AAYAEQMMRPDLFDCLCCDLESWRQLAGLFQPFMFVNGALTVRGVPIEARRLRELNHIRE
HLNLPLVRSAATEEPGAPLTTPPTLHGNQARASGYFMVLIRAKLDSYSSFTTSPSEAVMR
EHAYSRARTKNNYGSTIEGLLDLPDDDAPEEAGLAAPRLSFLPAGHTRRLSTAPPTDVSL
GDELHLDGEDVAMAHADALDDFDLDMLGDGDSPGPGFTPHDSAPYGALDMADFEFEQMFT
DALGIDEYGG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM34505
NameBDBM34505
Synonyms:3-(4-tert-butylphenyl)-6-(2-pyridinyl)-[1,2,4]triazolo[3,4-b][1,3,4]thiadiazole | 3-(4-tert-butylphenyl)-6-(2-pyridyl)-[1,2,4]triazolo[3,4-b][1,3,4]thiadiazole | 3-(4-tert-butylphenyl)-6-pyridin-2-yl-[1,2,4]triazolo[3,4-b][1,3,4]thiadiazole | MLS000115739 | SMR000092768 | cid_848736
TypeSmall organic molecule
Emp. Form.C18H17N5S
Mol. Mass.335.426
SMILESCC(C)(C)c1ccc(cc1)-c1nnc2sc(nn12)-c1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a