BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOxysterols receptor LXR-beta
LigandBDBM115112
Substrate/Competitorn/a
Meas. Tech.Counterscreen for agonists of the daf-12 abnormal Dauer Formation: Luminescence-based cell-based dose response screening assay to identify agonists of the Liver-X-Receptor (LXR)
EC50 67535±n/a nM
Citation PubChem, PC Counterscreen for agonists of the daf-12 abnormal Dauer Formation: Luminescence-based cell-based dose response screening assay to identify agonists of the Liver-X-Receptor (LXR) PubChem Bioassay(2013)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Oxysterols receptor LXR-beta
Name:Oxysterols receptor LXR-beta
Synonyms:Liver X receptor beta (NR1H2) | Liver X, LXR beta | Nuclear receptor NER | Ubiquitously-expressed nuclear receptor
Type:Protein
Mol. Mass.:50978.79
Organism:Homo sapiens (Human)
Description:P55055
Residue:460
Sequence:
MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQ
SQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKR
SFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQI
ALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMR
RLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRM
LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM115112
NameBDBM115112
Synonyms:(3S,3aR)-1-allyl-2-keto-3-(2-keto-2-thiomorpholino-ethyl)-4,5,6,7-tetrahydro-3H-cyclohepta[b]pyrrole-3a-carboxylic acid methyl ester | (3S,3aR)-2-oxo-3-(2-oxo-2-thiomorpholin-4-ylethyl)-1-prop-2-enyl-4,5,6,7-tetrahydro-3H-cyclohepta[b]pyrrole-3a-carboxylic acid methyl ester | MLS004259454 | SMR003089419 | cid_60158113 | methyl (3S,3aR)-2-oxidanylidene-3-(2-oxidanylidene-2-thiomorpholin-4-yl-ethyl)-1-prop-2-enyl-4,5,6,7-tetrahydro-3H-cyclohepta[b]pyrrole-3a-carboxylate | methyl (3S,3aR)-2-oxo-3-(2-oxo-2-thiomorpholin-4-ylethyl)-1-prop-2-enyl-4,5,6,7-tetrahydro-3H-cyclohepta[b]pyrrole-3a-carboxylate
TypeSmall organic molecule
Emp. Form.C20H28N2O4S
Mol. Mass.392.512
SMILESCOC(=O)[C@@]12CCCCC=C1N(CC=C)C(=O)[C@H]2CC(=O)N1CCSCC1 |c:9|
Structure
n/a