Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAurora kinase B
LigandBDBM116823
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
IC50 0.06±n/a nM
Citation Sutton, AELan, RRichardson, TEPerrey, DVandeveer, HGHuck, BRKarra, SRChen, XXiao, YLiu-Bujalski, LGoutopoulos, AStieber, FHodous, BLQiu, HJones, RHeasley, BH Amino azaheterocyclic carboxamides US Patent US8637532 Publication Date 1/28/2014
More Info.:Get all data from this article,  Assay Method
 
Aurora kinase B
Name:Aurora kinase B
Synonyms:AIM-1 | Aurora B kinase (aurB) | Aurora B-INCENP | Aurora kinase 2 | Aurora kinase B (AURKB) | Aurora-related kinase 2 | STK-1 | Serine/threonine-protein kinase aurora B
Type:Protein
Mol. Mass.:39327.72
Organism:Homo sapiens (Human)
Description:Q96GD4
Residue:344
Sequence:
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM116823
NameBDBM116823
Synonyms:US8637532, 549
TypeSmall organic molecule
Emp. Form.C22H17N7O
Mol. Mass.395.4167
SMILESNC(=O)c1cccc2c(NCc3cccc(Nc4cc(ccn4)C#N)c3)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a