Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrace amine-associated receptor 1 (TAAR1)
LigandBDBM119186
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
Ki 112.7±n/a nM
Citation Nettekoven, MNorcross, RPolara, A Dihydrooxazol-2-amine derivatives US Patent US8673950 Publication Date 3/18/2014
More Info.:Get all data from this article,  Assay Method
 
Trace amine-associated receptor 1 (TAAR1)
Name:Trace amine-associated receptor 1 (TAAR1)
Synonyms:Trace amine receptor 1 (TARR1) | Trace amine-associated receptor1
Type:Protein
Mol. Mass.:37635.41
Organism:Mus musculus (Mouse)
Description:Q923Y8
Residue:332
Sequence:
MHLCHAITNISHRNSDWSREVQASLYSLMSLIILATLVGNLIVIISISHFKQLHTPTNWL
LHSMAIVDFLLGCLIMPCSMVRTVERCWYFGEILCKVHTSTDIMLSSASIFHLAFISIDR
YCAVCDPLRYKAKINISTILVMILVSWSLPAVYAFGMIFLELNLKGVEELYRSQVSDLGG
CSPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRTNVQVGLEGKSQAPQ
SKETKAAKTLGIMVGVFLVCWCPFFLCTVLDPFLGYVIPPSLNDALYWFGYLNSALNPMV
YAFFYPWFRRALKMVLLGKIFQKDSSRSKLFL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM119186
NameBDBM119186
Synonyms:US8673950, 53
TypeSmall organic molecule
Emp. Form.C18H21N5O2
Mol. Mass.339.3916
SMILESCCC(=O)c1cnc(Nc2ccc(CC[C@H]3COC(N)=N3)cc2)nc1 |r,c:19|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a