Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAurora kinase B/Inner centromere protein
LigandBDBM50381716
Substrate/Competitorn/a
Meas. Tech.Enzyme Inhibtion Assay
IC50 6.73±n/a nM
Citation Michaelides, MRFrey, RCurtin, M Thieno[3,2-C]pyridine kinase inhibitors with improved CYP safety profile US Patent US8722890 Publication Date 5/13/2014
More Info.:Get all data from this article,  Assay Method
 
Aurora kinase B/Inner centromere protein
Name:Aurora kinase B/Inner centromere protein
Synonyms:AIM-1 | Aurora B kinase (aurB) | Aurora B-INCENP | Aurora kinase 2 | Aurora kinase B | Aurora kinase B (AURKB) | Aurora-related kinase 2 | STK-1 | Serine/threonine-protein kinase aurora B
Type:Protein
Mol. Mass.:39327.72
Organism:Homo sapiens (Human)
Description:Q96GD4
Residue:344
Sequence:
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50381716
NameBDBM50381716
Synonyms:ABT-348 | ILORASERTIB | US8722890, 1 | US8722890, 2
TypeSmall organic molecule
Emp. Form.C25H21FN6O2S
Mol. Mass.488.537
SMILESNc1ncc(-c2cnn(CCO)c2)c2scc(-c3ccc(NC(=O)Nc4cccc(F)c4)cc3)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a