Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 5
LigandBDBM123316
Substrate/Competitorn/a
Meas. Tech.Binding Assay
pH7.8±n/a
IC50 86.02±n/a nM
Commentsextracted
Citation Duffy, JLBao, JOndeyka, DLTyagarajan, SShao, PYe, FKatipally, RZwicker, ASherer, ECPlotkin, MAMoningka, RHussain, ZWood, HBUjjainwalla, FRomero, FAFinke, PEZang, YLiu, W Spiroxazolidinone compounds US Patent US8742110 Publication Date 6/3/2014
More Info.:Get all data from this article,  Assay Method
 
Somatostatin receptor type 5
Name:Somatostatin receptor type 5
Synonyms:SOMATOSTATIN SST5 | SS-5-R | SS5-R | SS5R | Somatostatin receptor type 5 (SSTR5)
Type:Enzyme
Mol. Mass.:39218.02
Organism:Homo sapiens (Human)
Description:P35346
Residue:364
Sequence:
MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTL
VIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDG
VNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADV
QEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRR
RSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCAN
PVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQ
TSKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM123316
NameBDBM123316
Synonyms:US8742110, 6-34
TypeSmall organic molecule
Emp. Form.C30H27N3O5
Mol. Mass.509.5525
SMILESOC(=O)c1ccc(cc1)N1CC2(CCN(Cc3nc(oc3-c3ccccc3)-c3ccccc3)CC2)OC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a