Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrace amine-associated receptor 1 (TAAR1)
LigandBDBM129471
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding
pH7.4±n/a
Temperature310.15±n/a K
Ki 87.7±n/a nM
Commentsextracted
Citation Galley, GNorcross, RDPflieger, P Heterocyclic amine derivatives US Patent US8802673 Publication Date 8/12/2014
More Info.:Get all data from this article,  Assay Method
 
Trace amine-associated receptor 1 (TAAR1)
Name:Trace amine-associated receptor 1 (TAAR1)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:40296.65
Organism:Rattus norvegicus (Rat)
Description:Q923X8
Residue:358
Sequence:
MATDDDRFPWDQDSILSRDLLSASSMQLCYEKLNRSCVRSPYSPGPRLILYAVFGFGAVL
AVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGLTVMPFSMVRSVEGCWYFGDIYC
KFHSSFDGSFCYSSIFHLCFISADRYIAVSDPLIYPTRFTASVSGKCITFSWLLSIIYSF
SLFYTGVNEAGLEDLVSALTCVGGCQIAVNQSWVFINFLLFLVPALVMMTVYSKIFLIAK
QQAQNIEKMGKQTARASESYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLG
FVTPTYVYEILVWIGYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILRENSSATNLFPE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM129471
NameBDBM129471
Synonyms:US8802673, 113
TypeSmall organic molecule
Emp. Form.C19H20N4O
Mol. Mass.320.3883
SMILESC1CO[C@H](CN1)c1ccc(Nc2cc(n[nH]2)-c2ccccc2)cc1 |r|
Structure
n/a