Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 17A1
LigandBDBM132193
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
IC50>10000±n/a nM
Citation Bock, MGGaul, CGunmadi, VRSengupta, S Inhibitors of CYP 17 US Patent US Patent
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 17A1
Name:Cytochrome P450 17A1
Synonyms:CYPXVII | Cytochrome P450 C17 (CYP17 ) | Cytochrome P450 C17 (CYP17) | Cytochrome P450 CYP17 | Cytochrome P450-C17 | Cytochrome P450-C17 (CYP17) | P450-C17 | Steroid 17-alpha-Monooxygenase (CYP17) | Steroid 17-alpha-hydroxylase/17,20 lyase | Steroid 17-alpha-monooxygenase | cytochrome P450 monooxygenase 17 alpha hydroxylase/17,20-lyase (CYP17)
Type:Enzyme
Mol. Mass.:57382.42
Organism:Homo sapiens (Human)
Description:E.coli expressing human CYP17
Residue:508
Sequence:
MWELVALLLLTLAYLFWPKRRCPGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKY
GPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAH
WQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVIS
LICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRN
DLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIF
GAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREV
LRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNP
AGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIP
KVVFLIDSFKVKIKVRQAWREAQAEGST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM132193
NameBDBM132193
Synonyms:USRE45173, 132A
TypeSmall organic molecule
Emp. Form.C17H17N5O
Mol. Mass.307.3498
SMILESCc1ccncc1N1CCN(C1=O)c1ccc2nn(C)cc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a