Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetChymase
LigandBDBM134276
Substrate/Competitorn/a
Meas. Tech.Inhibitory Assay
pH7.5±n/a
Temperature298.15±n/a K
IC50 9±n/a nM
Commentsextracted
Citation Muto, TTanaka, TFutamura, JImajo, SSugawara, H Seven-membered ring compound and pharmaceutical use therefor US Patent US8846660 Publication Date 9/30/2014
More Info.:Get all data from this article,  Assay Method
 
Chymase
Name:Chymase
Synonyms:Alpha-chymase | Chymase precursor | Mast cell protease I
Type:Enzyme
Mol. Mass.:27340.12
Organism:Homo sapiens (Human)
Description:n/a
Residue:247
Sequence:
MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
NQILQAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM134276
NameBDBM134276
Synonyms:US8846660, 76
TypeSmall organic molecule
Emp. Form.C30H32ClN5O6
Mol. Mass.594.058
SMILESCC[C@@H](NC(=O)N1C\C(NCC(Cc2cc(Cl)ccc2OC)C1=O)=N\Oc1ccccc1)c1ccc(C(O)=O)c(N)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a