Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial
LigandBDBM137784
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH8±n/a
Temperature303.15±n/a K
IC50 189±n/a nM
Commentsextracted
Citation Motomura, TNagamori, HSuzawa, KIto, HMorita, TKobayashi, SShinkai, H Fluorene compound and pharmaceutical use thereof US Patent US8871934 Publication Date 10/28/2014
More Info.:Get all data from this article,  Assay Method
 
[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial
Name:[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial
Synonyms:Pyruvate dehydrogenase kinase 2 (PDK2) | Pyruvate dehydrogenase kinase isoenzyme 1 (PDK2)
Type:Enzyme
Mol. Mass.:46153.78
Organism:Homo sapiens (Human)
Description:Q15119
Residue:407
Sequence:
MRWVWALLKNASLAGAPKYIEHFSKFSPSPLSMKQFLDFGSSNACEKTSFTFLRQELPVR
LANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIR
NRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGST
NPAHPKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVY
VPSHLYHMLFELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI
ERLFSYMYSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYL
KALSTDSVERLPVYNKSAWRHYQTIQEAGDWCVPSTEPKNTSTYRVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM137784
NameBDBM137784
Synonyms:US8871934, 377
TypeSmall organic molecule
Emp. Form.C18H13F3N2O
Mol. Mass.330.3038
SMILESCn1cc(cn1)-c1ccc2-c3ccccc3C(O)(c2c1)C(F)(F)F
Structure
n/a