Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetChymase
LigandBDBM144347
Substrate/Competitorn/a
Meas. Tech.In Vitro Assay
pH8±n/a
IC50 7±n/a nM
Commentsextracted
Citation Abeywardane, AHao, MTaylor, SJ Chymase inhibitors US Patent US8969348 Publication Date 3/3/2015
More Info.:Get all data from this article,  Assay Method
 
Chymase
Name:Chymase
Synonyms:Alpha-chymase | Chymase precursor | Mast cell protease I
Type:Enzyme
Mol. Mass.:27340.12
Organism:Homo sapiens (Human)
Description:n/a
Residue:247
Sequence:
MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
NQILQAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM144347
NameBDBM144347
Synonyms:US8969348, {4-[(1,4-Dimethyl-1H-indol-3-yl)methyl]-1-oxophthalazin-2(1H)-yl}(phenyl)acetic acid
TypeSmall organic molecule
Emp. Form.C27H23N3O3
Mol. Mass.437.4898
SMILESCc1cccc2n(C)cc(Cc3nn(C(C(O)=O)c4ccccc4)c(=O)c4ccccc34)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a