Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetApoptosis regulator Bcl-2
LigandBDBM145200
Substrate/Competitorn/a
Meas. Tech.Time Resolved-Fluorescence Resonance Energy Transfer (TR-FRET) Assay
Temperature298.15±n/a K
Ki<0.01±n/a nM
Commentsextracted
Citation Ding, HDoherty, GAElmore, SWHexamer, LKunzer, ARPark, CSong, XSouers, AJSullivan, GMTao, ZWang, LWendt, MDCzabotar, PELessene, GLColman, PM Apoptosis-inducing agents for the treatment of cancer and immune and autoimmune diseases US Patent US8952157 Publication Date 2/10/2015
More Info.:Get all data from this article,  Assay Method
 
Apoptosis regulator Bcl-2
Name:Apoptosis regulator Bcl-2
Synonyms:Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | Bcl-2 Protein
Type:Homodimer or heterodimer
Mol. Mass.:26269.11
Organism:Homo sapiens (Human)
Description:P10415
Residue:239
Sequence:
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM145200
NameBDBM145200
Synonyms:US8952157, 391 | US9303025, 391
TypeSmall organic molecule
Emp. Form.C48H56Cl2F2N8O7S
Mol. Mass.997.975
SMILESNc1ncc(Oc2cc(ccc2C(=O)NS(=O)(=O)c2ccc(NCC3CCOCC3)c(c2)[N+]([O-])=O)N2CCN(CC3=C(CCC4(CCN(CC4)C(CF)CF)C3)c3ccc(Cl)cc3)CC2)cc1Cl |t:43|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a