Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEndothelial lipase
LigandBDBM151304
Substrate/Competitorn/a
Meas. Tech.Biological Assay
pH8±n/a
Temperature298.15±n/a K
IC50 18±n/a nM
Commentsextracted
Citation Finlay, HJiang, JKim, SParkhurst, BQiao, JXWang, TCPi, ZTora, GOLloyd, JJohnson, JA Amide, urea or sulfone amide linked benzothiazole inhibitors of endothelial lipase US Patent US8987314 Publication Date 3/24/2015
More Info.:Get all data from this article,  Assay Method
 
Endothelial lipase
Name:Endothelial lipase
Synonyms:EDL | EL | Endothelial cell-derived lipase | LIPG
Type:Protein
Mol. Mass.:56805.62
Organism:Homo sapiens (Human)
Description:Q9Y5X9
Residue:500
Sequence:
MSNSVPLLCFWSLCYCFAAGSPVPFGPEGRLEDKLHKPKATQTEVKPSVRFNLRTSKDPE
HEGCYLSVGHSQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVV
VDWLPLAHQLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGYAGN
FVKGTVGRITGLDPAGPMFEGADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHID
IYPNGGDFQPGCGLNDVLGSIAYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDS
NRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRAGMPFRVYHYQMKIHVFSYKN
MGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLVYTEEDLGDLLKIQLTWEGAS
QSWYNLWKEFRSYLSQPRNPGRELNIRRIRVKSGETQRKLTFCTEDPENTSISPGRELWF
RKCRDGWRMKNETSPTVELP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM151304
NameBDBM151304
Synonyms:US8987314, B102
TypeSmall organic molecule
Emp. Form.C29H30N4O7S3
Mol. Mass.642.766
SMILESNS(=O)(=O)CCNC(=O)C(c1nc2ccc(cc2s1)-c1ccc(cc1)C(=O)N1CCOCC1)S(=O)(=O)Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a