Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcium release-activated calcium channel
LigandBDBM152938
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
Temperature310.15±n/a K
IC50 139±n/a nM
Commentsextracted
Citation Muthuppalaniappan, MViswanadha, SVaranasi, KVMerikapudi, GSVakkalanka, SK Modulators of calcium release-activated calcium channel and methods for treatment of non-small cell lung cancer US Patent US8993612 Publication Date 3/31/2015
More Info.:Get all data from this article,  Assay Method
 
Calcium release-activated calcium channel
Name:Calcium release-activated calcium channel
Synonyms:CRACM1 | Calcium channel (VER) | Calcium release-activated calcium channel protein 1 | ORAI1 | Protein orai-1 | TMEM142A | Transmembrane protein 142A
Type:Protein
Mol. Mass.:32676.63
Organism:Homo sapiens (Human)
Description:Q96D31
Residue:301
Sequence:
MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSY
SEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDADHDYPPGLL
IAFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFST
VIGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQAAAIAST
TIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHY
A
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM152938
NameBDBM152938
Synonyms:US8993612, 21
TypeSmall organic molecule
Emp. Form.C21H17F3N6O
Mol. Mass.426.3945
SMILESFC(F)(F)c1cc(C2CC2)n(n1)-c1ccc(NC(=O)Cn2nc3ccccc3n2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a