Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetcis-Decaprenyl diphosphate synthase (cis-DPPS)
LigandBDBM153338
Substrate/Competitorn/a
Meas. Tech.DPPS Inhibition (GPP based) Assay
pH7.5±n/a
IC50 2.0e+4± 0 nM
Commentsextracted
Citation Kim, MOFeng, XFeixas, FZhu, WLindert, SBogue, SSinko, Wde Oliveira, CRao, GOldfield, EMcCammon, JA A Molecular Dynamics Investigation of Mycobacterium tuberculosis Prenyl Synthases: Conformational Flexibility and Implications for Computer-aided Drug Discovery. Chem Biol Drug Des85:756-69 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cis-Decaprenyl diphosphate synthase (cis-DPPS)
Name:cis-Decaprenyl diphosphate synthase (cis-DPPS)
Synonyms:n/a
Type:Protein
Mol. Mass.:33800.02
Organism:Mycobacterium tuberculosis H37Rv
Description:n/a
Residue:296
Sequence:
MARDARKRTSSNFPQLPPAPDDYPTFPDTSTWPVVFPELPAAPYGGPCRPPQHTSKAAAP
RIPADRLPNHVAIVMDGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAF
STENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEM
TKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLNPERITESTIARHLQRPDIPDVD
LFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM153338
NameBDBM153338
Synonyms:BPH-1330
TypeSmall organic molecule
Emp. Form.C18H24O5
Mol. Mass.320.3802
SMILESCCCCCCCCOc1ccc(cc1)C(=O)\C=C(/O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a