Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta amyloid A4 protein
LigandBDBM155098
Substrate/Competitorn/a
Meas. Tech.Release Assay
Temperature310.15±n/a K
IC50 2±n/a nM
Commentsextracted
Citation Karlstrom, SCsjernyik, GSwahn, BSandberg, LKolmodin, KSoderman, POhberg, L 2H-imidazol-4-amine compounds and their use as BACE inhibitors US Patent US9000182 Publication Date 4/7/2015
More Info.:Get all data from this article,  Assay Method
 
Beta amyloid A4 protein
Name:Beta amyloid A4 protein
Synonyms:ABPP | AICD-50 | AICD-57 | AICD-59 | AID(50) | AID(57) | AID(59) | APP | APPI | Alzheimer disease amyloid protein | Amyloid beta A4 protein | Amyloid beta Protein | Amyloid beta protein (sAPPbeta) | Amyloid beta protein Abeta(1-42) | Amyloid intracellular domain 50 | Amyloid intracellular domain 57 | Amyloid intracellular domain 59 | Amyloid protein (Abeta42b) | Beta-APP40 | Beta-APP42 | Beta-amyloid protein 40 | Beta-amyloid protein 42 | C31 | C83 | C99 | CVAP | Cerebral vascular amyloid peptide | Gamma Secretase | Gamma-CTF(50) | Gamma-CTF(57) | Gamma-CTF(59) | Gamma-secretase | Gamma-secretase C-terminal fragment 50 | Gamma-secretase C-terminal fragment 57 | Gamma-secretase C-terminal fragment 59 | P3(40) | P3(42) | PN-II | PreA4 | Protease nexin-II | S-APP-alpha | S-APP-beta | Soluble APP-alpha | Soluble APP-beta | beta-Amyloid Precursor Protein (APP)
Type:Single-pass type I membrane protein
Mol. Mass.:86890.41
Organism:Homo sapiens (Human)
Description:n/a
Residue:770
Sequence:
MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTK
TCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVG
EFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFR
GVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEE
EADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPC
RAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARD
PVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQA
KNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITAL
QAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYER
MNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTET
KTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTN
IKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL
VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM155098
NameBDBM155098
Synonyms:US9000182, 7, isomer 1
TypeSmall organic molecule
Emp. Form.C24H29N3O
Mol. Mass.375.5066
SMILESCO[C@H]1CC[C@@]2(Cc3ccc(cc3[C@]22N=C(C)C(N)=N2)C#CC2CCC2)CC1 |r,wD:5.5,2.1,13.15,c:20,t:16,(8.27,-3.04,;7.5,-1.7,;5.96,-1.7,;5.19,-.37,;3.65,-.37,;2.88,-1.7,;1.97,-2.95,;.51,-2.47,;-.83,-3.24,;-2.16,-2.47,;-2.16,-.93,;-.83,-.16,;.51,-.93,;1.97,-.46,;.72,.45,;1.2,1.91,;.43,3.24,;2.74,1.91,;3.51,3.24,;3.22,.45,;-3.49,-.16,;-4.83,.61,;-6.16,1.38,;-6.93,2.71,;-8.27,1.94,;-7.5,.61,;3.65,-3.04,;5.19,-3.04,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a