Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin A (CTSA)
LigandBDBM156813
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH5.5±n/a
Temperature298.15±n/a K
IC50 90.1±n/a nM
Commentsextracted
Citation Ruf, SSadowski, TWirth, KSchreuder, HBuning, C Substituted 3-heteroaroylamino-propionic acid derivatives and their use as pharmaceuticals US Patent US9029559 Publication Date 5/12/2015
More Info.:Get all data from this article,  Assay Method
 
Cathepsin A (CTSA)
Name:Cathepsin A (CTSA)
Synonyms:Cathepsin A | Lysosomal protective protein
Type:Protein
Mol. Mass.:54465.95
Organism:Homo sapiens (Human)
Description:P10619
Residue:480
Sequence:
MIRAAPPPLFLLLLLLLLLVSWASRGEAAPDQDEIQRLPGLAKQPSFRQYSGYLKGSGSK
HLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLI
ANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYA
GIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHC
CSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQD
LGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWD
MCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKME
VQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM156813
NameBDBM156813
Synonyms:US9029559, 244
TypeSmall organic molecule
Emp. Form.C24H23FN2O4
Mol. Mass.422.4488
SMILESCOc1ccc(nc1-c1cccc(F)c1C)C(=O)N[C@@H](CC(O)=O)c1ccc(C)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a