Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSolute carrier family 22 member 12
LigandBDBM165667
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH7.4±n/a
IC50 13±n/a nM
Commentsextracted
Citation Storer, RISwain, NAOwen, RM Chemical compounds US Patent US9067922 Publication Date 6/30/2015
More Info.:Get all data from this article,  Assay Method
 
Solute carrier family 22 member 12
Name:Solute carrier family 22 member 12
Synonyms:OATL4 | Organic anion transporter 4-like protein | RST | Renal-specific transporter | SLC22A12 | Solute carrier family 22 member 12 (URAT1) | URAT1 | Urate anion exchanger 1 | Urate anion exchanger 1 (URAT1) | Uric Acid Transporter 1 (URAT1)
Type:Enzyme
Mol. Mass.:59638.65
Organism:Homo sapiens (Human)
Description:Q96S37
Residue:553
Sequence:
MAFSELLDLVGGLGRFQVLQTMALMVSIMWLCTQSMLENFSAAVPSHRCWAPLLDNSTAQ
ASILGSLSPEALLAISIPPGPNQRPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGW
VYDRSIFTSTIVAKWNLVCDSHALKPMAQSIYLAGILVGAAACGPASDRFGRRLVLTWSY
LQMAVMGTAAAFAPAFPVYCLFRFLLAFAVAGVMMNTGTLLMEWTAARARPLVMTLNSLG
FSFGHGLTAAVAYGVRDWTLLQLVVSVPFFLCFLYSWWLAESARWLLTTGRLDWGLQELW
RVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFRTCISTLCWFAF
GFTFFGLALDLQALGSNIFLLQMFIGVVDIPAKMGALLLLSHLGRRPTLAASLLLAGLCI
LANTLVPHEMGALRSALAVLGLGGVGAAFTCITIYSSELFPTVLRMTAVGLGQMAARGGA
ILGPLVRLLGVHGPWLPLLVYGTVPVLSGLAALLLPETQSLPLPDTIQDVQNQAVKKATH
GTLGNSVLKSTQF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM165667
NameBDBM165667
Synonyms:US9067922, 1
TypeSmall organic molecule
Emp. Form.C19H10ClFN4O3S
Mol. Mass.428.824
SMILESFc1ccc(NS(=O)(=O)c2ccc(Oc3ccc(C#N)c(Cl)c3)c(c2)C#N)nc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a