Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-lipoxygenase/FLAP
LigandBDBM167213
Substrate/Competitorn/a
Meas. Tech.Homogeneous Time Resolved Fluorescence Assay
Ki 691.4±n/a nM
Citation Eccles, WFitzgerald, AEHack, MDHawryluk, NAJones, WMKeith, JMKrawczuk, PLebsack, ADLiu, JMani, NSMcClure, KJMeduna, SPRosen, MD Flap modulators US Patent US9073876 Publication Date 7/7/2015
More Info.:Get all data from this article,  Assay Method
 
5-lipoxygenase/FLAP
Name:5-lipoxygenase/FLAP
Synonyms:5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | FLAP | MK-886-binding protein
Type:Enzyme
Mol. Mass.:18159.90
Organism:Homo sapiens (Human)
Description:P20292
Residue:161
Sequence:
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM167213
NameBDBM167213
Synonyms:US9073876, 294 | US9732093, Compound 294
TypeSmall organic molecule
Emp. Form.C16H19FN4O
Mol. Mass.302.3467
SMILESNCCOc1c(F)c(ccc1C1CCC1)-c1cnc(N)cn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a