Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-dependent kinase 9
LigandBDBM167604
Substrate/Competitorn/a
Meas. Tech.LANCE ULight TR-FRET Kinase Assay
IC50 34±n/a nM
Citation Gong, JTao, ZPenning, TDSouers, AJTong, YZhu, G Pyrrolo[2,3-B]pyridine CDK9 kinase inhibitors US Patent US9073922 Publication Date 7/7/2015
More Info.:Get all data from this article,  Assay Method
 
Cyclin-dependent kinase 9
Name:CDK4/CDK9
Synonyms:C-2K | CDC2L4 | CDK9 | Cell division cycle 2-like protein kinase 4 | Cell division protein kinase 9 | Cyclin-Dependent Kinase 9 (CDK9) | Cyclin-dependent kinase 9 (CDK9) | Serine/threonine-protein kinase PITALRE | TAK | Tat-associated kinase complex catalytic subunit
Type:Enzyme Subunit
Mol. Mass.:42789.13
Organism:Homo sapiens (Human)
Description:n/a
Residue:372
Sequence:
MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFP
ITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVK
FTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNS
QPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLAL
ISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDP
AQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNP
ATTNQTEFERVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM167604
NameBDBM167604
Synonyms:US9073922, 89 | US9796708, Example 89
TypeSmall organic molecule
Emp. Form.C24H31N5O
Mol. Mass.405.5358
SMILESCN1CCC(CC1)c1cc2c(ccnc2[nH]1)-c1cccc(NCC2CCOCC2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a