Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHomo sapiens phosphodiesterase 2A (PDE2A)
LigandBDBM171833
Substrate/Competitorn/a
Meas. Tech.Radioactive Assay
Temperature298.15±n/a K
IC50 155±n/a nM
Commentsextracted
Citation Giovannini, RBertani, BFrattini, SDi Antonio, GLankau, HStange, HGrunwald, CHöfgen, NLangen, BEgerland, U Substituted pyrido[3,2-E][1,2,4]-triazolo[4,3-A]pyrazines for the treatment of central nervous system disorders US Patent US9085584 Publication Date 7/21/2015
More Info.:Get all data from this article,  Assay Method
 
Homo sapiens phosphodiesterase 2A (PDE2A)
Name:Homo sapiens phosphodiesterase 2A (PDE2A)
Synonyms:3'',5''-cyclic phosphodiesterase | 3'',5''-cyclic phosphodiesterase (PDE2A) | CGS-PDE | Cyclic GMP-stimulated phosphodiesterase | NM_002599 | PDE2A | cGMP-dependent 3'',5''-cyclic phosphodiesterase | cGSPDE
Type:Enzyme Catalytic Domain
Mol. Mass.:105691.58
Organism:Homo sapiens (Human)
Description:n/a
Residue:941
Sequence:
MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPQPCADSLQDALLSLGSVIDI
SGLQRAVKEALSAVLPRVETVYTYLLDGESQLVCEDPPHELPQEGKVREAIISQKRLGCN
GLGFSDLPGKPLARLVAPLAPDTQVLVMPLADKEAGAVAAVILVHCGQLSDNEEWSLQAV
EKHTLVALRRVQVLQQRGPREAPRAVQNPPEGTAEDQKGGAAYTDRDRKILQLCGELYDL
DASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCLGQVV
EDKKSIQLKDLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEGDLFTD
EDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITE
ARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPD
AYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAF
SIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNF
ASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMH
AFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYS
SEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDL
QKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAM
GNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSH
KFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDAE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM171833
n/a
NameBDBM171833
Synonyms:US9085584, 3
TypeSmall organic molecule
Emp. Form.C16H13N5O
Mol. Mass.291.3073
SMILESCc1ccc2nc(C)c3nnc(-c4cccc(O)c4)n3c2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: