Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin S
LigandBDBM50323258
Substrate/Competitorn/a
Meas. Tech.In Vitro Inhibition Assay
IC50 234±n/a nM
Citation Cai, JBennett, DJJones, PS 1H-[1,2,3]triazolo[4,5-c]pyridine-4-carbonitrile derivatives US Patent US9115126 Publication Date 8/25/2015
More Info.:Get all data from this article,  Assay Method
 
Cathepsin S
Name:Cathepsin S
Synonyms:CTSS | Cathepsin S (Cat S) | cathepsin S preproprotein
Type:Protein
Mol. Mass.:37507.38
Organism:Homo sapiens (Human)
Description:P25774
Residue:331
Sequence:
MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVM
LHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVD
WREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGC
NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKE
AVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW
GHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50323258
NameBDBM50323258
Synonyms:6-(4-(3-hydroxypropyl)-3-(trifluoromethyl)phenyl)-1-methyl-1H-imidazo[4,5-c]pyridine-4-carbonitrile | CHEMBL1208910 | US9115126, WO 2009/010491, Example 15
TypeSmall organic molecule
Emp. Form.C18H15F3N4O
Mol. Mass.360.3331
SMILESCn1cnc2c(nc(cc12)-c1ccc(CCCO)c(c1)C(F)(F)F)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a