Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldehyde oxidase (AO)
LigandBDBM19461
Substrate/Competitorn/a
Meas. Tech.AO Enzyme Assay
Ki 1.48e+5± 1.62e+4 nM
IC50 2.12e+5± 0 nM
Citation Siah, MFarzaei, MHAshrafi-Kooshk, MRAdibi, HArab, SSRashidi, MRKhodarahmi, R Inhibition of guinea pig aldehyde oxidase activity by different flavonoid compounds: An in vitro study. Bioorg Chem64:74-84 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldehyde oxidase (AO)
Name:Aldehyde oxidase (AO)
Synonyms:Aldehyde: O2 oxidoreductase
Type:Protein
Mol. Mass.:145280.02
Organism:Cavia porcellus (Guinea pig)
Description:H9TB17
Residue:1332
Sequence:
MEPSTLYFYVNGRRVTEKNVDPETMLLPYLGRNLRLTGTKYGCGGGGCGACTVMVSRYDR
GTGQIRHYPACACLTPLCSLHGAAVTTVEGVGSTRTRLHPVQERIAKSHGTQCGFCTPGM
VMSLYALLRSHPQPSEEQLLEALAGNLCRCTGYRPILDAGKTFCKTSGCCQSKENGVCCL
DQGVNGVQEAEGEQTSQELCSEEEFVPLDPTQELIFPPELMILAQKQPQKSRVFTGDRVT
WISPVTLKDLLEAKAKNPRAPVVMGNTSVGPEMKFKGVFHPVIISPDGIEELSVIKQGNE
GLTLGAGLSLAQVQDVLADVVQQLPEEKTQTLCALLKQLRTLAGSQIRNMASLGGHIMSR
HLDSDLNPVLAAASCTLHVPSQEGDRQIPLDEHFLSRSPSADLRPQEVLLSVTIPYSRKW
EFVSAFRQAQRKRSARAIVNVGMRVFFGAGDGVISELCILYGGVGPAIVCATDACRKLVG
RHWTEEMLDEACRLVLGEVAIPGAAPGGRVEFRRTLLVSFLFRFYLQVSQSLSRMDPGRY
PSLVGKYESALEDLCLGHHQRTFELQSADAKQLPQDPIGRPIMHLSGIKHTTGEAIYCDD
MPLVDRELSLAFVTSSRAHAAILSMDLSEALSLPGVVDIVTAEHLGDANSFAKETLLATD
KVLCVGHLVCAVIADSEVQAKRAAEKVKIVYQDLEPLILTIEEAIQHDSFFETERKLESG
DVAEAFRTAEQVLEGSIHMGGQEHFYMETQSMLAVPKGEDQEIDLYVSTQFPTYIQEIVA
STLKLPVNKVMCHVRRVGGAFGGKVGKTAILAAITAFAALKHCRAVRCILERGEDMLITG
GRHPYLGKYKVGFRNNGQVVALDMEHYSNAGSTLDESLMVVEMGLLKMENAYKFPNLRCR
GHACKTNLPSNTALRGFGFPQSGLITEACIVEVAARCGLSPEEVREVNMYRGTEQTHYGQ
EIHTQRLAQCWSECKAKATFSLRRAAVDRFNAGSPWKKRGLAMVPLKFPVGLGSVAMGQA
AALVHVYLDGSVLLTHGGIEMGQGVHTKMIQVVSRELKMPMANVHLRGTSTETVPNANVS
GGSVVADLNGLAVKDACQTLLKRLEPIISKNPKGTWKEWAQAAFDQSISLSAIGYFRGYD
ADMDWEKGKGHPFEYFVYGAACSEVEIDCLTGNHKNIRTDIVMDVGRSINPALDLGQVEG
AFIQGMGLYTSEELKYGPQGALYTRGPDQYKIPAVCDVPAELHVFFLPPSKNSNTLYSSK
GLGESGVFLGCSVLFAIWDAVSAARRERGLPGTLALSCPLTPEKIRMACEDRFTKMIPRD
TPGSYVPWDVVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM19461
n/a
NameBDBM19461
Synonyms:α-CA inhibitor, 5 | 5,7-dihydroxy-2-(4-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one | CHEMBL32571 | Naringenin | Naringenin (NAR) | naringetol | salipurpol
TypeEstrgen Antagonist
Emp. Form.C15H12O5
Mol. Mass.272.2528
SMILESOc1ccc(cc1)C1CC(=O)c2c(O)cc(O)cc2O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: