Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2b
LigandBDBM50310922
Substrate/Competitorn/a
Meas. Tech.Fluorometric Imaging Plate Reader (FLIPR) Asssay
IC50 7.1±n/a nM
Citation Jordan, ABedford, SBurkhard, KYule, IPoullennec, K Thienopyrimidine compounds US Patent US9120807 Publication Date 9/1/2015
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2b
Name:Adenosine receptors; A2b & A3
Synonyms:ADENOSINE A2B | ADORA2B | Adenosine receptor A2B (A2B)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36341.22
Organism:Homo sapiens (Human)
Description:n/a
Residue:332
Sequence:
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA
IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT
RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT
FHKIISRYLLCQADVKSGNGQAGVQPALGVGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50310922
n/a
NameBDBM50310922
Synonyms:CHEMBL1080241 | US9120807, 9 | {6-Amino-2-[(pyridin-3-ylmethyl)-amino]-thieno[3,2-d]pyrimidin-4-yl}-thiophen-2-yl-methanone
TypeSmall organic molecule
Emp. Form.C17H13N5OS2
Mol. Mass.367.448
SMILESNc1cc2nc(NCc3cccnc3)nc(C(=O)c3cccs3)c2s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: