Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetα-glucosidase
LigandBDBM179777
Substrate/Competitorn/a
Meas. Tech.Assay for α-Glucosidase Inhibitory Activity
IC50 1.61e+4± 1e+2 nM
Citation Taha, MIsmail, NHImran, SMohamad, MHWadood, ARahim, FSaad, SMRehman, AUKhan, KM Synthesis, a-glucosidase inhibitory, cytotoxicity and docking studies of 2-aryl-7-methylbenzimidazoles. Bioorg Chem65:100-9 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
α-glucosidase
Name:α-glucosidase
Synonyms:Alpha-glucosidase | Alpha-glucosidase (α-glucosidase) | Oligo-1,6-glucosidase
Type:Protein
Mol. Mass.:68577.59
Organism:Saccharomyces cerevisiae S288c (Baker's yeast)
Description:n/a
Residue:589
Sequence:
MTISSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWIS
PFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWF
KESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCS
TQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQS
SDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGEMQHASDETKRLYTSASRHELSEL
FNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRF
GDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIK
EEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGIN
VEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAA
LNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM179777
NameBDBM179777
Synonyms:2-(2'-Hydroxyphenyl)-7-methyl-1H-benzo[d]imidazole (19)
TypeSmall organic molecule
Emp. Form.C14H12N2O
Mol. Mass.224.2579
SMILESCc1cccc2nc([nH]c12)-c1ccccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a