Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProto-oncogene tyrosine-protein kinase Src (c-Src)
LigandBDBM185674
Substrate/Competitorn/a
Meas. Tech.Kinome-Wide Inhibitor Profiling for Phosphorylated c-Abl
Kd 11±5 nM
Citation Kwarcinski, FEBrandvold, KRPhadke, SBeleh, OMJohnson, TKMeagher, JLSeeliger, MAStuckey, JASoellner, MB Conformation-Selective Analogues of Dasatinib Reveal Insight into Kinase Inhibitor Binding and Selectivity. ACS Chem Biol11:1296-304 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Proto-oncogene tyrosine-protein kinase Src (c-Src)
Name:Proto-oncogene tyrosine-protein kinase Src (c-Src)
Synonyms:Proto-oncogene tyrosine-protein kinase Src
Type:Protein
Mol. Mass.:32360.42
Organism:Gallus gallus (Chicken)
Description:Wild-type chicken c-Src kinase domain (251-533aa)
Residue:283
Sequence:
QTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQE
AQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGEMGKYLRLPQLVDMAAQI
ASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTA
PEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPES
LHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM185674
NameBDBM185674
Synonyms:4-[4-[(5-tert-butyl-2-quinolin-6-ylpyrazol-3-yl)carbamoylamino]-3-fluorophenoxy]-N-methylpyridine-2-carboxamide | Rebastinib
TypeSmall organic molecule
Emp. Form.C30H28FN7O3
Mol. Mass.553.5868
SMILESCNC(=O)c1cc(Oc2ccc(NC(=O)Nc3cc(nn3-c3ccc4ncccc4c3)C(C)(C)C)c(F)c2)ccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a