Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman diphtheria toxin-like ADP-ribosyltransferase (ARTD6 or PARP5b)
LigandBDBM185818
Substrate/Competitorn/a
Meas. Tech.Biochemical Assay
Temperature298.15±n/a K
IC50 5±1 nM
Commentsextracted
Citation Chen, CHChin, DNDiPietro, LVFan, JPalermo, MGShultz, MDToure, B 4-piperidinyl compounds for use as tankyrase inhibitors US Patent US9163003 Publication Date 10/20/2015
More Info.:Get all data from this article,  Assay Method
 
Human diphtheria toxin-like ADP-ribosyltransferase (ARTD6 or PARP5b)
Name:Tankyrase 1/2
Synonyms:(ARTD6 or PARP5b) | Tankyrase 1/2 | Tankyrase-1 (TNKS1) | Tankyrase-2 | Tankyrase-2 (TNKS-2) | Tankyrase-2 (TNKS2)
Type:Enzyme
Mol. Mass.:126937.16
Organism:Homo sapiens (Human)
Description:Q9H2K2
Residue:1166
Sequence:
MSGRRCAGGGAACASAAAEAVEPAARELFEACRNGDVERVKRLVTPEKVNSRDTAGRKST
PLHFAAGFGRKDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVNLLLRHGADPNAR
DNWNYTPLHEAAIKGKIDVCIVLLQHGAEPTIRNTDGRTALDLADPSAKAVLTGEYKKDE
LLESARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAK
DKGDLVPLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSYG
ADPTLLNCHNKSAIDLAPTPQLKERLAYEFKGHSLLQAAREADVTRIKKHLSLEMVNFKH
PQTHETALHCAAASPYPKRKQICELLLRKGANINEKTKEFLTPLHVASEKAHNDVVEVVV
KHEAKVNALDNLGQTSLHRAAYCGHLQTCRLLLSYGCDPNIISLQGFTALQMGNENVQQL
LQEGISLGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVS
VVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAA
AKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLAR
VKKLSSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAA
SYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQT
PLDLVSADDVSALLTAAMPPSALPSCYKPQVLNGVRSPGATADALSSGPSSPSSLSAASS
LDNLSGSFSELSSVVSSSGTEGASSLEKKEVPGVDFSITQFVRNLGLEHLMDIFEREQIT
LDVLVEMGHKELKEIGINAYGHRHKLIKGVERLISGQQGLNPYLTLNTSGSGTILIDLSP
DDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEEN
HNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTG
CPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYV
IYRGEQAYPEYLITYQIMRPEGMVDG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM185818
NameBDBM185818
Synonyms:US9163003, 30
TypeSmall organic molecule
Emp. Form.C26H28N4O4
Mol. Mass.460.5249
SMILESCOc1ccc(cc1)C(=O)C1CCN(CC1)[C@H]1CCN(Cc2nc3ccccc(=O)c3[nH]2)C1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a