Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 2A (5HT2A)
LigandBDBM186932
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
pH7.4±n/a
Ki 2066±n/a nM
Commentsextracted
Citation Besnard, JHopkins, ALGilbert, IRuda, GFAbecassis, K Morpholino compounds, uses and methods US Patent US9079895 Publication Date 7/14/2015
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 2A (5HT2A)
Name:Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
Synonyms:5-HT-2 | 5-HT-2A | 5-hydroxytryptamine receptor 2A | Serotonin 2a (5-HT2a) receptor
Type:Enzyme
Mol. Mass.:52843.00
Organism:Mus musculus (Mouse)
Description:P35363
Residue:471
Sequence:
MEILCEDNISLSSIPNSLMQLGDDSRLYPNDFNSRDANTSEASNWTIDAENRTNLSCEGY
LPPTCLSILHLQEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VAFFIPLTIMVITYFLTIKSLQKEATLCVSDLSTRAKLSSFSFLPQSSLSSEKLFQRSIH
REPGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENRKPLQLILVNTIPTLAYK
SSQLQVGQKKNSQEDAEPTANDCSMVTLGNQHSEEMCTDNIETVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM186932
NameBDBM186932
Synonyms:US9079895, 22r
TypeSmall organic molecule
Emp. Form.C21H23ClN2O3
Mol. Mass.386.872
SMILESClc1cccc(OC[C@H]2CN(CC(=O)N3CCc4ccccc34)CCO2)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a