Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 1 (S1P1)
LigandBDBM60834
Substrate/Competitorn/a
Meas. Tech.Calcium Mobilization Assay
EC50>55400±n/a nM
Citation Grobelny, DWGill, GS S1P receptors modulators US Patent US9181182 Publication Date 11/10/2015
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-phosphate receptor 1 (S1P1)
Name:Arachidonate 15-lipoxygenase
Synonyms:15-Lipoxygenase-1 (15-LOX-1) | Arachidonate 15-lipoxygenase-1 | Reticulocyte 15-lipoxygenase-1
Type:Protein
Mol. Mass.:74804.05
Organism:Homo sapiens (Human)
Description:n/a
Residue:662
Sequence:
MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPL
LFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDP
QGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAK
GLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVV
LRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPL
VMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSH
LLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMST
GGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVS
LHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQH
ASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQ
PVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSV
AI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM60834
NameBDBM60834
Synonyms:US9181182, 30
Typen/a
Emp. Form.C31H38N4O4
Mol. Mass.530.6578
SMILESCOc1ccc(cc1C12CC3CC(CC(C3)C1)C2)-c1nc(no1)-c1ccc2N(CC(N)(CO)CO)CCc2c1 |TLB:15:10:17:13.16.14,15:14:17:11.10.9,11:12:10.9.15:16,THB:11:10:12.17.13:16|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a