Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetalpha-glucosidase (Gaa)
LigandBDBM190536
Substrate/Competitorn/a
Meas. Tech.Enzyme Activity Assay
pH4±n/a
EC50 121000±11400 nM
Commentsextracted
Citation Mugrage, BLee, GZhu, XBoyd, RSheth, K Method for the treatment of pompe disease using 1-deoxynojirimycin and derivatives US Patent US9181184 Publication Date 11/10/2015
More Info.:Get all data from this article,  Assay Method
 
alpha-glucosidase (Gaa)
Name:alpha-glucosidase (Gaa)
Synonyms:α-Glucosidase | Acid maltase | Lysosomal alpha-glucosidase
Type:Enzyme
Mol. Mass.:106235.32
Organism:Mus musculus (Mouse)
Description:P70699
Residue:953
Sequence:
MNIRKPLCSNSVVGACTLISLTTAVILGHLMLRELMLLPQDLHESSSGLWKTYRPHHQEG
YKPGPLHIQEQTEQPKEAPTQCDVPPSSRFDCAPDKGISQEQCEARGCCYVPAGQVLKEP
QIGQPWCFFPPSYPSYRLENLSSTESGYTATLTRTSPTFFPKDVLTLQLEVLMETDSRLH
FKIKDPASKRYEVPLETPRVLSQAPSPLYSVEFSEEPFGVIVRRKLGGRVLLNTTVAPLF
FADQFLQLSTSLPSQHITGLGEHLSPLMLSTDWARITLWNRDTPPSQGTNLYGSHPFYLA
LEDGGLAHGVFLLNSNAMDVILQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLDVVGY
PFMPPYWGLGFHLCRWGYSSTAIVRQVVENMTRTHFPLDVQWNDLDYMDARRDFTFNQDS
FADFPDMVRELHQDGRRYMMIVDPAISSAGPAGSYRPYDEGLRRGVFITNETGQPLIGKV
WPGTTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWLDMNEPSNFVRGSQQGCPNNELEN
PPYVPGVVGGILQAATICASSHQFLSTHYNLHNLYGLTEAIASSRALVKTRGTRPFVISR
STFSGHGRYAGHWTGDVRSSWEHLAYSVPDILQFNLLGVPLVGADICGFIGDTSEELCVR
WTQLGAFYPFMRNHNDLNSVPQEPYRFSETAQQAMRKAFALRYALLPYLYTLFHRAHVRG
DTVARPLFLEFPEDPSTWSVDRQLLWGPALLITPVLEPGKTEVTGYFPKGTWYNMQMVSV
DSLGTLPSPSSASSFRSAVQSKGQWLTLEAPLDTINVHLREGYIIPLQGPSLTTTESRKQ
PMALAVALTASGEADGELFWDDGESLAVLERGAYTLVTFSAKNNTIVNKLVRVTKEGAEL
QLREVTVLGVATAPTQVLSNGIPVSNFTYSPDNKSLAIPVSLLMGELFQISWS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM190536
NameBDBM190536
Synonyms:US9181184, 23
TypeSmall organic molecule
Emp. Form.C14H18F3NO4
Mol. Mass.321.2922
SMILESOC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)CN1Cc1ccc(cc1)C(F)(F)F |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a