Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProlylcarboxypeptidase (PRCP)
LigandBDBM193266
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
Ki 135400±n/a nM
Citation Shariat-Madar, ZRimoldi, JMGadepalli, RS Selective inhibitors of prolylcarboxypeptidase US Patent US9193762 Publication Date 11/24/2015
More Info.:Get all data from this article,  Assay Method
 
Prolylcarboxypeptidase (PRCP)
Name:Lysosomal Pro-X carboxypeptidase
Synonyms:Angiotensinase C | Lysosomal carboxypeptidase C | PRCP | Proline carboxypeptidase | Prolylcarboxypeptidase
Type:Enzyme
Mol. Mass.:55805.19
Organism:Homo sapiens (Human)
Description:P42785
Residue:496
Sequence:
MGRRALLLLLLSFLAPWATIALRPALRALGSLHLPTNPTSLPAVAKNYSVLYFQQKVDHF
GFNTVKTFNQRYLVADKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFA
EHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELIKHLKRTIPGAENQPVIAIGGSY
GGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRS
WDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISETWVNLAMVDYPYASNFLQP
LPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETATSSLGTLGWS
YQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGKNISSHT
NIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSLEVRH
MKNWIRDFYDSAGKQH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM193266
NameBDBM193266
Synonyms:US9193762, RS-33-11
TypeSmall organic molecule
Emp. Form.C26H28F3N3O4
Mol. Mass.503.5134
SMILESFC(F)(F)c1ccccc1CNC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)OCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a