Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProlylcarboxypeptidase (PRCP)
LigandBDBM193289
Substrate/Competitorn/a
Meas. Tech.Activation Assay
Ki 6.4e+3± 0 nM
Citation Shariat-Madar, ZRimoldi, JMGadepalli, RS Selective inhibitors of prolylcarboxypeptidase US Patent US9193762 Publication Date 11/24/2015
More Info.:Get all data from this article,  Assay Method
 
Prolylcarboxypeptidase (PRCP)
Name:Lysosomal Pro-X carboxypeptidase
Synonyms:Angiotensinase C | Lysosomal carboxypeptidase C | PRCP | Proline carboxypeptidase | Prolylcarboxypeptidase
Type:Enzyme
Mol. Mass.:55805.19
Organism:Homo sapiens (Human)
Description:P42785
Residue:496
Sequence:
MGRRALLLLLLSFLAPWATIALRPALRALGSLHLPTNPTSLPAVAKNYSVLYFQQKVDHF
GFNTVKTFNQRYLVADKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFA
EHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELIKHLKRTIPGAENQPVIAIGGSY
GGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRS
WDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISETWVNLAMVDYPYASNFLQP
LPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETATSSLGTLGWS
YQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGKNISSHT
NIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSLEVRH
MKNWIRDFYDSAGKQH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM193289
NameBDBM193289
Synonyms:US9193762, RS-42-01
TypeSmall organic molecule
Emp. Form.C21H41N3O2
Mol. Mass.367.5691
SMILESCCCCCCCCCCCCNC(=O)CCCNC(=O)[C@@H]1CCCN1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a